Taxezopidine H

CAS No. 205440-23-9

Taxezopidine H( —— )

Catalog No. M32523 CAS No. 205440-23-9

The heartwoods of Taxus cuspidata.

Purity : >98% (HPLC)

COA Datasheet HNMR HPLC MSDS Handing Instructions
Size Price / USD Stock Quantity
5MG 551 In Stock
50MG Get Quote In Stock
100MG Get Quote In Stock

Biological Information

  • Product Name
    Taxezopidine H
  • Note
    Research use only, not for human use.
  • Brief Description
    The heartwoods of Taxus cuspidata.
  • Description
    The heartwoods of Taxus cuspidata.
  • In Vitro
    ——
  • In Vivo
    ——
  • Synonyms
    ——
  • Pathway
    Others
  • Target
    Other Targets
  • Recptor
    ——
  • Research Area
    ——
  • Indication
    ——

Chemical Information

  • CAS Number
    205440-23-9
  • Formula Weight
    608.7
  • Molecular Formula
    C35H44O9
  • Purity
    >98% (HPLC)
  • Solubility
    DMSO, Pyridine, Methanol, Ethanol, etc.
  • SMILES
    ——
  • Chemical Name
    ——

Shipping & Storage Information

  • Storage
    (-20℃)
  • Shipping
    With Ice Pack
  • Stability
    ≥ 2 years

Reference

molnova catalog
related products
  • pro - ε - Tx1X/12

    pro - ε - Tx1X/12

  • Exendin-4 peptide de...

    FTSDVSKQMEEEAVRLFIEWLKNGGPSSGAPPPS is an Exendin-4 peptide derivative.Exendin-4 peptide derivatives are structurally derived from Exendin-4 and may relates to dual GLP-1/glucagon receptor agonists.

  • PF-4840154

    PF-4840154 is a potent, selective agonist of the rat and human TrpA1 channel and elicited TrpA1-mediated nocifensive behaviour in mouse, with EC50 of 97 nM and 23 nM for rTrpA1 and hTrpA1, respectively.